32-facebook 32-twitter 32-linkedin 32-youtube-2

 

 

0 item(s) - $0.00
  • Recombinant Murine CXCL12

CXCL12 is a ligand for the G protein coupled receptor CXCR4, and induces chemotactic migration in a wide range of CXCR4-expressing cells. CXCL12 protein is expressed in E. coli, refolded and cleaved to yield the native, secreted form of the mature chemokine.

Amino Acid Sequence:

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Molecular Weight:  7973.28 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: Assessed by HPLC, Mass Spectrometry, and NMR
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

J Biol Chem. 2000 Jul 21;275(29):22313-23. https://www.ncbi.nlm.nih.gov/pubmed/10781587

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Murine CXCL12

  • Product Code: PFP069
  • Availability: In Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CXCL12, SDF1, Murine Chemokine, mouse CXCL12, , mouse SDF1