32-facebook 32-twitter 32-linkedin 32-youtube-2

 

{module Search}

0 item(s) - $0.00
  • Recombinant Human CCL26

Recombinant human CCL26 is expressed in E. coli, refolded and purified to yield a mature form of either 68 or 71 amino acids that is secreted from cells after cleavage of the signal peptide. Human CCL26, also known as IMAC, eotaxin 3, and MIP4-alpha, recruits eosinophils and basophils by activating the CCR3 receptor.

Amino Acid Sequence:

TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

Molecular Weight:  8395.82 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

J Biol Chem. 1999 Sep 24;274(39):27975-80. https://www.ncbi.nlm.nih.gov/pubmed/10488147

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CCL26

  • Product Code: CCL26
  • Availability: Out Of Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CCL26, Eotaxin-3, IMAC