32-facebook 32-twitter 32-linkedin 32-youtube-2

 

{module Search}

0 item(s) - $0.00
  • Recombinant Human CCL24

Recombinant human CCL24 1-78 is expressed in E. coli, refolded and purified to yield the mature  protein that is secreted from cells after cleavage of the signal peptide as originally described by Forssmann et al. Human CCL23, also designated eotaxin-2 and Macrophage inflammatory protein 3 (MIP-2), attracts eosinophils and resting T cells through activation of the G protein-coupled receptor CCR3. A longer form of CCL24 Additional proteolytic processing at the N terminus (e.g. CCL23 25-99) reportedly yields a more potent form of the chemokine.

Amino Acid Sequence:

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA

Molecular Weight:  8838.41 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

J Exp Med. 1997 Jun 16;185(12):2171-6. https://www.ncbi.nlm.nih.gov/pubmed/?term=9182688

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CCL24

  • Product Code: CCL24
  • Availability: Out Of Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CCL24, Eotaxin-2, MPIF-2