32-facebook 32-twitter 32-linkedin 32-youtube-2

 

 

0 item(s) - $0.00
  • Recombinant Human CCL18 (1-68)

CCL18 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine. CCL18, previously identified as DC-CK1 or PARC, is expressed by dendritic cells and is chemotactic for naïve T cells. The 7 transmembrane GPCR CCR8 and the 6 transmembrane protein,  membrane-associated phosphatidylinositol transfer protein 3, PITPNM3, are receptors for CCL18. The ligand was shown to have antagonist properties against CCR3.

Amino Acid Sequence:

QVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Molecular Weight:  7784.11 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: Assessed by HPLC, Mass Spectrometry, and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButtonRCSBButton   

References:

Nature. 1997 Jun 12;387(6634):713-7. https://www.ncbi.nlm.nih.gov/pubmed/?term=9192897

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CCL18 (1-68)

  • Product Code: PFP052
  • Availability: In Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CCL18 (1-68), MIP4, MIP-4, PARC