32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CXCL17

Recombinant human CXCL17 protein is expressed in E. coli, refolded and purified as a 96 residue polypeptide. Human CXCL17, also known as Dendritic cell and monocyte chemokine-like protein (DMC), or as VEGF-correlated chemokine-1 (VCC-1) is the ligand for the G protein coupled receptor 35 (GPR35) or CXCR8. Recent research documents that CXCL17 plays a role in tumor progression and inflamation and human disease. Studies also suggest that CXCL17 has an important physiological role in both homeostatic and inflammatory conditions.

Amino Acid Sequence:

LNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL

Molecular Weight:  11326.13 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

Burkhardt, A. M., Maravillas-Montero, J. L., Carnevale, C. D., Vilches-Cisneros, N., Flores, J. P., Hevezi, P. A., & Zlotnik, A. (2014). CXCL17 is a Major Chemotactic factor for lung Macrophages. The Journal of Immunology, 193(3), 1468–1474. doi:10.4049/jimmunol.1400551

If you publish research with this product, please let us know so we can cite your paper.

Write a review

Note: HTML is not translated!
    Bad           Good

Recombinant Human CXCL17

  • Product Code: CXCL17
  • Availability: Inquire
  • $0.00

  • Ex Tax: $0.00

Available Options


Tags: Cytokine, Chemokine, CXCL17, VCC-1, DMC