32-facebook 32-twitter 32-linkedin 32-youtube-2

 

{module Search}

0 item(s) - $0.00
  • Recombinant Human CXCL9

Recombinant human CXCL9 is expressed in E. coli, refolded and purified to yield the mature form of protein that is secreted from cells after cleavage of the signal peptide. Human CXCL9 is a 103 amino acid protein expressed by IFN-gamma macrophages and glial cells.

T-cells expressing the G protein-coupled receptor, CXCR3, will migrate and release intracellular calcium in response to CXCL9 stimulation.

Amino Acid Sequence:

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Molecular Weight:  11720.81 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

Weng, Y., Siciliano, S. J., Waldburger, K. E., Sirotina-Meisher, A., Staruch, M. J., Daugherty, B. L., . . . DeMartino, J. A. (1998). Binding and functional properties of recombinant and endogenous CXCR3 chemokine receptors. J Biol Chem, 273(29), 18288-18291.   

Loetscher, M., Gerber, B., Loetscher, P., Jones, S. A., Piali, L., Clark-Lewis, I., . . . Moser, B. (1996). Chemokine receptor specific for IP10 and mig: structure, function, and expression in activated T-lymphocytes. J Exp Med, 184(3), 963-969

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CXCL9

  • Product Code: CXCL9
  • Availability: In Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CXCL9, MIG, Monokine Induced by Interferon-gamma