32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CXCL2

Recombinant human CXCL2 is expressed in E. coli, refolded and purified to yield the mature protein that is secreted from cells after cleavage of the signal peptide. Human CXCL2 is a 73 amino acid, ELR+ chemokine that belongs to the GRO isoform subset which activate the G protein-coupled receptors CXCR2. LPS-stimulated macrophages strongly express CXCL2 in addition to the constitutive expression by macrophages. CXCL1 is a potent chemoattractant for neutrophils and hematopoietic stem cells and an activator of basophils.

Amino Acid Sequence:

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Molecular Weight:  7888.42 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: Assessed by HPLC, Mass Spectrometry, and NMR
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

Becker, S., Quay, J., Koren, H. S., & Haskill, J. S. (1994). Constitutive and stimulated MCP-1, GRO alpha, beta, and gamma expression in human airway epithelium and bronchoalveolar macrophages. Am J Physiol, 266(3 Pt 1), L278-286.

Pelus, L. M., & Fukuda, S. (2006). Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol, 34(8), 1010-1020. doi:10.1016/j.exphem.2006.04.004

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CXCL2

  • Product Code: PFP030
  • Availability: In Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CXCL2, GRO-ß, MIP-2α, GRO2