32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CX3CL1

Recombinant human CX3CL1 protein is expressed in E. coli, refolded and purified to yield the 76 residue chemokine domain of the polypeptide. Human CX3CL1 is a membrane protein consisting of a mucin-like stalk attached to a transmembrane domain containing  a C-terminal tail. CX3CL1 is the ligand to the G protein coupled receptor CX3CR1. CX3CL1 and its receptor have been shown to be a involved in the cellular processes leading to atherosclerosis, where a deletion of the gene specific to the CX3CR1 receptor in transgenic mouse models lead to a decrease in the disease.

Amino Acid Sequence:

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Molecular Weight:  8634.99 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

The disintegrin-like metalloproteinase ADAM10 is involved in constitutive cleavage of CX3CL1 (fractalkine) and regulates CX3CL1-mediated cell-cell adhesion. Hundhausen C, Misztela D, Berkhout TA, Broadway N, Saftig P, Reiss K, Hartmann D, Fahrenholz F, Postina R, Matthews V, Kallen KJ, Rose-John S, Ludwig A. Blood. 2003 Aug 15;102(4):1186-95. Epub 2003 Apr 24. Identification and molecular characterization of fractalkine receptor CX3CR1, which mediates both leukocyte migration and adhesion. Imai T, Hieshima K, Haskell C, Baba M, Nagira M, Nishimura M, Kakizaki M, Takagi S, Nomiyama H, Schall TJ, Yoshie O. Cell. 1997 Nov 14;91(4):521-30. https://www.ncbi.nlm.nih.gov/pubmed/9024663

If you publish research with this product, please let us know so we can cite your paper.

Write a review

Note: HTML is not translated!
    Bad           Good

Recombinant Human CX3CL1

  • Product Code: CX3CL1
  • Availability: Inquire
  • $0.00

  • Ex Tax: $0.00

Available Options


0 reviews / Write a review


Tags: Cytokine, Chemokine, lymphotactin, CXCL14