32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CCL28 (4-108)

Recombinant human CCL28 is expressed in E. coli, refolded and purified to yield the mature form of protein that is secreted from cells after cleavage of the signal peptide. Human CCL28 is chemokine that  is constitutively expressed by epithelial cells in diverse mucosal tissues and is known to attract a variety of immune cell types including T-cell subsets and eosinophilsthrough activation of the G protein-coupled receptors CCR10 and CCR3. CCL28 contains an extended C-terminal domain consisting of ~40 flexible amino acids. In addition to the two disulfide bonds that are conserved throughout the chemokine family, two additional cysteine residues at positions 30 and 80 form a novel disulfide linkage between the folded chemokine domain and the flexible C-terminus. Human CCL28 is expressed as an immature polypeptide 127 amino acids in length. Two different mature N-terminal sequences have been described due to uncertainty in the site of cleavage by signal peptidase. CCL28(4-108) is described in the NCIB GenPept entry as the mature form based on an ab initio prediction of the site of signal peptide cleavage. It consists of residues 23-127 of the expressed protein and may exhibit higher potency as a CCR10 agonist than the longer version [CCL28(1-108)] that includes three additional N-terminal residues (link to CCL28 1-108 product page).

Amino Acid Sequence:

ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Molecular Weight:  12074 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

J Biol Chem. 2000 Jul 21;275(29):22313-23. https://www.ncbi.nlm.nih.gov/pubmed/10781587

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CCL28 (4-108)

  • Product Code: PFP026
  • Availability: In Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CCL28, Mucosa-Associated Epithelial Chemokine, MEC