32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CCL27

Recombinant human CCL27 is expressed in E. coli, refolded and purified to yield the mature form of protein that is secreted from cells after cleavage of the signal peptide. Human CCL27, also designated cutaneous T-cell-attracting chemokine (CTACK), attracts skin-associated memory T-lymphocytesthrough activation of the G protein-coupled receptor CCR10.

Amino Acid Sequence:

FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Molecular Weight:  10149.92 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

J Immunol. 2000 Apr 1;164(7):3465-70. https://www.ncbi.nlm.nih.gov/pubmed/10725697

If you publish research with this product, please let us know so we can cite your paper.

Write a review

Note: HTML is not translated!
    Bad           Good

Recombinant Human CCL27

  • Product Code: CCL27
  • Availability: Inquire
  • $0.00

  • Ex Tax: $0.00

Available Options


0 reviews / Write a review


Tags: Cytokine, Chemokine, CCL27, Cutaneous T-Cell Attracting Chemokine, CTACK