32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CCL22

CCL22 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine. CCL22, previously known as MDC, is most closely related to CCL17 and is expressed predominantly in the thymus. CCL22 is chemotactic for Th2 T cells and macrophages and signals through CCR4.

Amino Acid Sequence:

GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

Molecular Weight:  8090.47 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

J Biol Chem. 1998 Jan 16;273(3):1764-8. https://www.ncbi.nlm.nih.gov/pubmed/?term=9430724

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CCL22

  • Product Code: CCL22
  • Availability: Inquire
  • $0.00


Available Options


Tags: Cytokine, chemokine, CCL22, macrophage-derived chemokine, MDC