32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CCL19

CCL19 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine. Originally termed MIP-3beta or ELC, CCL19 is expressed in thymus and lymph nodes. The cognate receptor for CCL19 is CCR7 and directs the trafficking of B and T cells.

Amino Acid Sequence:

GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Molecular Weight:  8800.26 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

J Biol Chem. 1997 May 23;272(21):13803-9. https://www.ncbi.nlm.nih.gov/pubmed/?term=9153236 Science. 1998 Jan 16;279(5349):381-4. https://www.ncbi.nlm.nih.gov/pubmed/?term=9430588

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CCL19

  • Product Code: PFP021
  • Availability: In Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CCL19, ELC, Exodus-3, MIP3b