32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CCL5

Recombinant human CCL5 is expressed in E. coli, refolded and purified to yield the mature protein that is secreted from cells after cleavage of the signal peptide. Human CCL5, also known as Regulated upon Activation, Normal T cell Expressed and presumably Secreted (RANTES), attracts and activates leukocytes and plays a primary role in the inflammatory immune response.  CCL5 activates several G protein-coupled receptors including CCRs 1, 3, 4, and 5. CCL5 binding to CCR5 inhibits the infectivity of M-tropic HIV-1 strains. Proteolytic removal of the two N-terminal residues by CD26 generates a CCL5 variant that functions as a more potent HIV-1 inhibitor and a CCR5 antagonist.

Amino Acid Sequence:

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Molecular Weight:  7851 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

Nature. 1990 Oct 18;347(6294):669-71. https://www.ncbi.nlm.nih.gov/pubmed/1699135

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CCL5

  • Product Code: PFP020
  • Availability: In Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CCL5, RANTES