32-facebook 32-twitter 32-linkedin 32-youtube-2

 

 

0 item(s) - $0.00
  • Recombinant Human CXCL13 (1-87)

Recombinant human CXCL13 protein is expressed in E. coli, refolded and purified as the native form of the mature chemokine to yield an 87 residue polypeptide. Human CXCL13, also known as beta-cell attracting chemokine (BCA-1) or beta-cell ligand (BCL),  is the ligand for the G protein-coupled receptor CXCR5. CXCL13 is strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes over T cells and macrophages. 

Amino Acid Sequence:

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Molecular Weight:  10313.34 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: Assessed by HPLC, Mass Spectrometry, and NMR
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

Gunn, M. D., Ngo, V. N., Ansel, K. M., Ekland, E. H., Cyster, J. G., & Williams, L. T. (1998). A B-cell-homing chemokine made in lymphoid follicles activates Burkitt's lymphoma receptor-1. Nature, 391(6669), 799-803.  Retrieved from http://dx.doi.org/10.1038/35876

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CXCL13 (1-87)

  • Product Code: PFP019
  • Availability: In Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CXCL13, B-Lymphocyte Chemoattractant, BLC