32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CXCL13 (1-87)

Recombinant human CXCL13 protein is expressed in E. coli, refolded and purified as the native form of the mature chemokine to yield a 87 residue polypeptide. Human CXCL13, also known as beta cell attracting chemokine (BCA-1) or beta cell ligand (BCL),  is the ligand for the G protein coupled receptor CXCR5. CXCL13 is strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes over T cells and macrophages. 

Amino Acid Sequence:

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Molecular Weight:  10313.34 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

Gunn, M. D., Ngo, V. N., Ansel, K. M., Ekland, E. H., Cyster, J. G., & Williams, L. T. (1998). A B-cell-homing chemokine made in lymphoid follicles activates Burkitt's lymphoma receptor-1. Nature, 391(6669), 799-803.  Retrieved from http://dx.doi.org/10.1038/35876

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CXCL13 (1-87)

  • Product Code: PFP019
  • Availability: In Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CXCL13, B-Lymphocyte Chemoattractant, BLC