32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CXCL13 (1-71)

Recombinant human CXCL13 protein is expressed in E. coli,refolded and purified  to yield a 73 residue polypeptide. Human CXCL13,  also known as beta cell attracting chemokine (BCA-1) or beta cell ligand (BCL),  is the ligand for the G protein coupled receptor CXCR5. CXCL13 is strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes over T cells and macrophages.

Amino Acid Sequence:

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR

Molecular Weight:  8675.36
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

Gunn, M. D., Ngo, V. N., Ansel, K. M., Ekland, E. H., Cyster, J. G., & Williams, L. T. (1998). A B-cell-homing chemokine made in lymphoid follicles activates Burkitt's lymphoma receptor-1. Nature, 391(6669), 799-803.  Retrieved from http://dx.doi.org/10.1038/35876

If you publish research with this product, please let us know so we can cite your paper.

Write a review

Note: HTML is not translated!
    Bad           Good

Recombinant Human CXCL13 (1-71)

  • Product Code: CXCL13 (1-71)
  • Availability: Inquire
  • $0.00

  • Ex Tax: $0.00

Available Options


Tags: Cytokine, Chemokine, CXCL13, B-Lymphocyte Chemoattractant, BLC