32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CXCL10

Recombinant human CXCL10 is expressed in E. coli, refolded and purified to yield the mature form of protein that is secreted from cells after cleavage of the signal peptide. Human CXCL10 is a 77 amino acid protein that is expressed by monocytes, endothelial cells and fibroblasts. It is a potent T-cell chemoattractant through binding and activation of the G protein-coupled receptor CXCR3

Amino Acid Sequence:

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Molecular Weight:  8642.3 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

Weng, Y., Siciliano, S. J., Waldburger, K. E., Sirotina-Meisher, A., Staruch, M. J., Daugherty, B. L., . . . DeMartino, J. A. (1998). Binding and functional properties of recombinant and endogenous CXCR3 chemokine receptors. J Biol Chem, 273(29), 18288-18291.  

Luster, A. D., Unkeless, J. C., & Ravetch, J. V. (1985). Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins. Nature, 315(6021), 672-676.   

Dufour, J. H., Dziejman, M., Liu, M. T., Leung, J. H., Lane, T. E., & Luster, A. D. (2002). IFN-gamma-inducible protein 10 (IP-10; CXCL10)-deficient mice reveal a role for IP-10 in effector T cell generation and trafficking. J Immunol, 168(7), 3195-3204.

If you publish research with this product, please let us know so we can cite your paper.

Write a review

Note: HTML is not translated!
    Bad           Good

Recombinant Human CXCL10

  • Product Code: CXCL10
  • Availability: In Stock
  • $0.00

  • Ex Tax: $0.00

Available Options


0 reviews / Write a review


Tags: Cytokine, Chemokine, CXCL10, IP-10, IP10