32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CXCL8 (1-77)

Recombinant human CXCL8 is expressed in E. coli, refolded and purified to yield the mature form of protein that is secreted from cells after cleavage of the signal peptide. Human CXCL8 is a 77 amino acid protein that is the prototypical CXC chemokine which is expressed by fibroblasts and keratinocytes. Also known as Interleukin 8, this chemokine binds and activates two G protein-coupled receptors, CXCR1/CXCR2 on a variety of cells such as neutrophils, T-cells, endothelial cells, macrophages and keratinocytes.  CXCL8 is N-terminally processed to yield the major in vivo species, the 6-77 variant. (link to CXCL8 6-77 product page).

Amino Acid Sequence:

AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Molecular Weight:  8918.45 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

Clore, G. M., Appella, E., Yamada, M., Matsushima, K., & Gronenborn, A. M. (1989). Determination of the secondary structure of interleukin-8 by nuclear magnetic resonance spectroscopy. J Biol Chem, 264(32), 18907-18911.  

Clark-Lewis, I., Schumacher, C., Baggiolini, M., & Moser, B. (1991). Structure-activity relationships of interleukin-8 determined using chemically synthesized analogs. Critical role of NH2-terminal residues and evidence for uncoupling of neutrophil chemotaxis, exocytosis, and receptor binding activities. J Biol Chem, 266(34), 23128-23134.  

Larsen, C. G., Anderson, A. O., Oppenheim, J. J., & Matsushima, K. (1989). Production of interleukin-8 by human dermal fibroblasts and keratinocytes in response to interleukin-1 or tumour necrosis factor. Immunology, 68(1), 31-36.

If you publish research with this product, please let us know so we can cite your paper.

Write a review

Note: HTML is not translated!
    Bad           Good

Recombinant Human CXCL8 (1-77)

  • Product Code: CXCL8 (1-77)
  • Availability: Inquire
  • $0.00

  • Ex Tax: $0.00

Available Options


0 reviews / Write a review


Tags: Cytokine, Chemokine, CXCL8, Interleukin-8, IL-8, IL8, NAP-1, NAP1