32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CXCL4

Recombinant human CXCL4 is expressed in E. coli, refolded and purified to yield the mature form of protein that is secreted from cells after cleavage of the signal peptide. Human CXCL4, additionally known as Platelet-factor 4, is a 70 amino acid protein that is released by activated platelets to promote coagulation. CXCL4 binds to the G protein-coupled receptor CXCR3-B, found in kidney, heart and liver tissue, but a canonical signaling receptor is still unknown. CXCL4 readily binds to heparin-like molecules and glycoproteins and is a regulator of endothelial and homeopathic stem cell proliferation.

Amino Acid Sequence:

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Molecular Weight:  7765.18 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

MSDSButton   PubMedButton   RCSBButton

References:

Lasagni, L., Francalanci, M., Annunziato, F., Lazzeri, E., Giannini, S., Cosmi, L., . . . Romagnani, P. (2003). An alternatively spliced variant of CXCR3 mediates the inhibition of endothelial cell growth induced by IP-10, Mig, and I-TAC, and acts as functional receptor for platelet factor 4. J Exp Med, 197(11), 1537-1549. doi:10.1084/jem.20021897   

Amelot, A. A., Tagzirt, M., Ducouret, G., Kuen, R. L., & Le Bonniec, B. F. (2007). Platelet factor 4 (CXCL4) seals blood clots by altering the structure of fibrin. J Biol Chem, 282(1), 710-720. doi:10.1074/jbc.M606650200

If you publish research with this product, please let us know so we can cite your paper.

Write a review

Note: HTML is not translated!
    Bad           Good

Recombinant Human CXCL4

  • Product Code: CXCL4
  • Availability: In Stock
  • $0.00

  • Ex Tax: $0.00

Available Options


0 reviews / Write a review


Tags: Cytokine, Chemokine, CXCL4, PF-4, Platelet factor 4