32-facebook 32-twitter 32-linkedin 32-youtube-2

 

{module Search}

0 item(s) - $0.00
  • Recombinant Human CCL28

CCL28 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine.

CCL28 is a ligand for the G protein coupled receptors CCR10 and CCR3. It is expressed in many cell types and tissues including colon, salivary gland, mammary gland, and Paneth cells of the small intestine. CCL28 is chemotactic for CD4 and CD8 T-cells and eosinophils.

Amino Acid Sequence:

ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSP
HNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Molecular Weight:  12070.0 Da
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C

Additional comments or descriptive information:

MSDSButton    PubMedButton    ModBaseButton

References:

Wang, W., et al. (2000). "Identification of a novel chemokine (CCL28), which binds CCR10 (GPR2)." J Biol Chem 275(29): 22313-22323.

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human CCL28

  • Product Code: CCL28
  • Availability: In Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, CCL28