32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CXCL11

CXCL11 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine.

CXCL11 is a ligand for the G protein coupled receptors CXCR3 and CXCR7 whose production is induced by interferon production. It is expressed in many cell types including peripheral blood leukocytes, pancreas and liver astrocytes. CXCL11 induces calcium release in activated T-cells and is chemotactic for interleukin-stimulated T-cells.

Amino Acid Sequence:

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Molecular Weight:  8303.0 Da
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C

Additional comments or descriptive information:

MSDSButton    PubMedButton    RCSBButton

References:

Severin, I. C., et al. (2010). "Characterization of the chemokine CXCL11-heparin interaction suggests two different affinities for glycosaminoglycans." J Biol Chem 285(23): 17713-17724.
Clark-Lewis, I., et al. (2003). "Structure-function relationship between the human chemokine receptor CXCR3 and its ligands." J Biol Chem 278(1): 289-295.

If you publish research with this product, please let us know so we can cite your paper.

Write a review

Note: HTML is not translated!
    Bad           Good

Recombinant Human CXCL11

  • Product Code: CXCL11
  • Availability: In Stock
  • $0.00

  • Ex Tax: $0.00

Available Options


Tags: Cytokine, Chemokine, CXCL11