CXCL11 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine.
CXCL11 is a ligand for the G protein coupled receptors CXCR3 and CXCR7 whose production is induced by interferon production. It is expressed in many cell types including peripheral blood leukocytes, pancreas and liver astrocytes. CXCL11 induces calcium release in activated T-cells and is chemotactic for interleukin-stimulated T-cells.
Amino Acid Sequence:
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Molecular Weight: | 8303.0 Da |
Fusion Tag: | N/A |
Special Characteristic(s): | N/A |
Purity: | Assessed by HPLC, Mass Spectrometry, and NMR |
Source: | Human protein expressed in E. coli |
Physical Form: | Lyophilized powder |
Solubility: | Freely Soluble in Water |
Storage Conditions: | Store at -20o C |
Additional comments or descriptive information:
References:
Severin, I. C., et al. (2010). "Characterization of the chemokine CXCL11-heparin interaction suggests two different affinities for glycosaminoglycans." J Biol Chem 285(23): 17713-17724.
Clark-Lewis, I., et al. (2003). "Structure-function relationship between the human chemokine receptor CXCR3 and its ligands." J Biol Chem 278(1): 289-295.
If you publish research with this product, please let us know so we can cite your paper.
Recombinant Human CXCL11
- Product Code: PFP011
- Availability: In Stock
-
$0.00