32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CCL21

CCL21 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine.

CCL21 is a human chemokine that recruits normal immune cells and metastasizing tumor cells to lymph nodes through activation of the G protein-coupled receptor CCR7. CCL21 contains 6 conserved cysteines, in contrast to the 4 that are more typical of CC chemokines. CCL21 induces chemotactic migration of thymocytes and activated T-cells, but not B-cells, macrophages, or neutrophils.

Amino Acid Sequence:

SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDR

GASKTGKKGKGSKGCKRTERSQTPKGP

Molecular Weight:  12247.2 Da
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C

Additional comments or descriptive information:

MSDSButton    PubMedButton    RCSBButton

References:

Solution Structure of CCL21 and Identification of a Putative CCR7 Binding Site
Melissa Love, Jamie L. Sandberg, Joshua J. Ziarek, Kyle P. Gerarden, Renee R. Rode, Davin R. Jensen, Darrell R. McCaslin, Francis C. Peterson, and Christopher T. Veldkamp Biochemistry 2012 51 (3), 733-735

If you publish research with this product, please let us know so we can cite your paper.

Write a review

Note: HTML is not translated!
    Bad           Good

Recombinant Human CCL21

  • Product Code: CCL21
  • Availability: In Stock
  • $0.00

  • Ex Tax: $0.00

Available Options


Tags: Cytokine, Chemokine, CCL21