32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human XCL2 /Lymphotactin (Ltn)

XCL2 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine.

XCL2 is a ligand for the G protein coupled receptor XCR1 with and EC50 ~ 50 nM. XCL2, along with the closely related paralog XCL1, are the only two members the C-chemokine subfamily (1). Like XCL1, XCL2 shares similar structural and agonist properties. It is able to interconvert between two distinct conformations under physiological temperature and NaCl conditions. In one conformation, XCL2 exists as a monomer and is able to bind to its receptor. In the other conformation, XCL2 exists as a dimer and loses affinity for XCR1 (2,3)

Amino Acid Sequence:

VGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVV
RSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Molecular Weight:  10319.8 Daltons 
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C
   

Additional comments or descriptive information:

 

MSDSButton   PubMedButton   RCSBButton

References:

(1) Yoshida, T., Imai, T., Takagi, S., Nishimura, M., Ishikawa, I., Yaoi, T., & Yoshie, O. Structure and expression of two highly related genes encoding SCM-1/human lymphotactin. FEBS Letters 395, 82-88 (1996).
(2)Tunistra, R.L., Peterson, F.C., Elgin, E.S., Pelzek, A.J., & Volkman, B.F. An Engineered Second Disulfide Bond Restricts Lymphotactin/XCL1 to a Chemokine-­‐like Conformation with XCR1 Agonist Activity. Biochemistry 46, 2564-2573 (2007).
(3) Tunistra, R.L., Peterson, F.C., Kutlesa, S., Elgin, E.S., Kron, M.A., & Volkman, B.F. Interconversion between two unrelated protein folds in the lymphotactin native state. PNAS 105, 5057-5062 (2008).

If you publish research with this product, please let us know so we can cite your paper.

Recombinant Human XCL2 /Lymphotactin (Ltn)

  • Product Code: PFP006
  • Availability: In Stock
  • $0.00


Available Options


Tags: Cytokine, Chemokine, lymphotactin, SCYC1, LTN, LPTN, ATAC, SCM-1, XCL2