32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CXCL5

CXCL5 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine.

C-X-C motif chemokine 5 (CXCL5) or epithelial-derived neutrophil-activating peptide 78 (ENA-78) is a protein that in humans is encoded by the CXCL5 gene. The protein is a small cytokine belonging to the CXC chemokine family. CXCL5 is a ligand for the G protein coupled receptor CXCR2, and is expressed in monocytes, platelets, endothelial cells and mast cells. CXCL5 induces chemotactic migration in neutrophils. It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Expression of CXCL5 has also been observed in eosinophils, and can be inhibited with the type II interferon IFN-γ. This chemokine stimulates the chemotaxis of neutrophils possessing angiogenic properties.

Amino Acid Sequence:

AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Molecular Weight:  8352.8 Da
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C

Additional comments or descriptive information:

MSDSButton    PubMedButton   RCSBButton

References:

  1. Ahuja SK, Murphy PM. The CXC chemokines growth-regulated oncogene (GRO) alpha, GRObeta, GROgamma, neutrophil-activating peptide-2, and epithelial cell-derived neutrophil-activating peptide-78 are potent agonists for the type B, but not the type A, human interleukin-8 receptor. J Biol Chem 1996 271 20545-50.

If you publish research with this product, please let us know so we can cite your paper.

Write a review

Note: HTML is not translated!
    Bad           Good

Recombinant Human CXCL5

  • Product Code: CXCL5
  • Availability: In Stock
  • $0.00

  • Ex Tax: $0.00

Available Options


Tags: Cytokine, Chemokine, CXCL5