32-facebook 32-twitter 32-linkedin 32-youtube-2

 

0 item(s) - $0.00
  • Recombinant Human CCL20

CCL20 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine.

C-C motif chemokine 20 (CCL20) or liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP-3 alpha) is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. CCL20 is a ligand for the G protein coupled receptor CCR6, and induces chemotactic migration in a wide range of CCR6-expressing cells including immature dendritic cells (DC), effector/memory T-cells and B-cells. CCL20 is implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells towards the epithelial cells surrounding these tissues. CCL20 elicits its effects on its target cells by binding to and activating the chemokine receptor CCR6.

Amino Acid Sequence:

ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Molecular Weight:  8025.5 Da
Fusion Tag: N/A
Special Characteristic(s): N/A
Purity: > 98% by SDS-PAGE, HPLC, MALDI-MS and NMR.
Source: Human protein expressed in E. coli
Physical Form: Lyophilized powder
Solubility: Freely Soluble in Water
Storage Conditions: Store at -20o C

Additional comments or descriptive information:

MSDSButton    PubMedButton    RCSBButton

References:

Hieshima K, et al. Molecular cloning of a novel human CC chemokine liver and activation-regulated chemokine (LARC) expressed in liver. Chemotactic activity for lymphocytes and gene localization on chromosome 2. J Biol Chem. 1997 272 5846-53.

If you publish research with this product, please let us know so we can cite your paper.

Write a review

Note: HTML is not translated!
    Bad           Good

Recombinant Human CCL20

  • Product Code: CCL20
  • Availability: In Stock
  • $0.00

  • Ex Tax: $0.00

Available Options


0 reviews / Write a review


Tags: Cytokine, Chemokine, CCL20