CXCL12 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine.

C-X-C motif chemokine 12 is small cytokine belonging to the chemokine family that is also known as SDF-1 (stromal cell-derived factor-1). CXCL12 is a ligand for the G protein coupled receptor CXCR4, and induces chemotactic migration in a wide range of CXCR4-expressing cells. CXCL12 is strongly chemotactic for lymphocytes. During embryogenesis it directs the migration of hematopoietic cells from fetal liver to bone marrow and the formation of large blood vessels. In adulthood, CXCL12 plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow.

Amino Acid Sequence:

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Additional comments or descriptive information:

References:

1. Oberlin E et al. The CXC chemokine SDF-1 is the ligand for LESTR/fusin and prevents infection by T-cell-line-adapted HIV-1 Nature. 1996 382 833-5.
2. Bleul CC, et al The lymphocyte chemoattractant SDF-1 is a ligand for LESTR/fusin and blocks HIV-1 entry. Nature. 1996 382 829-33.

If you publish research with this product, please let us know so we can cite your paper.